PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_001520-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB_related
Protein Properties Length: 276aa    MW: 30259.4 Da    PI: 9.8769
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_001520-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.24.4e-1491135347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
  AHYPO_001520-RA  91 PWTEEEHKLFLLGLEKVGKGDWRGISRNFVKTRTPTQVASHAQKY 135
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.13784140IPR017930Myb domain
SuperFamilySSF466893.81E-1786141IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-1687139IPR006447Myb domain, plants
SMARTSM007176.2E-1088138IPR001005SANT/Myb domain
CDDcd001677.71E-1091136No hitNo description
Gene3DG3DSA:1.10.10.608.3E-1191135IPR009057Homeodomain-like
PfamPF002492.8E-1191135IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MANEDSMVVS GGGEIMLFGV RVVVDSMRKS VSLNNLSQYE HRLDSSSSTY DVVASAVPAV  60
NGGDYVSADE AVVTRSSSTG SASRERKRGI PWTEEEHKLF LLGLEKVGKG DWRGISRNFV  120
KTRTPTQVAS HAQKYFIRKS NLNRRGRRRS SLFDITTDSV AVNQTNDEQI SKDKNGPSQS  180
PPPQQQSSNV RFAVQPQESS RFSSPSSHIY SYNYEMNIMK PAPTSSNSTS SSSKSMADFD  240
LNLSLSLSSP SSDLTNPTHF TQRFNNVKDN IISVA*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00631PBMTransfer from PK23829.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010678650.12e-80PREDICTED: transcription factor MYB1R1-like
SwissprotQ2V9B03e-56MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A0J8CEP22e-80A0A0J8CEP2_BETVU; Uncharacterized protein
STRINGGLYMA05G01640.18e-57(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74840.25e-49MYB_related family protein